£0.00
Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
'A Swinging Christmas for Scrooge' - The Ben Holder Trio feat. Tom Kincaid
  • 'A Swinging Christmas for Scrooge' - The Ben Holder Trio feat. Tom Kincaid
'A Swinging Christmas for Scrooge' - The Ben Holder Trio feat. Tom Kincaid
£12.00 inc. tax
NEW FOR CHRISTMAS 2018

A brand new Christmas release for 2018 from The Ben Holder Trio, this time featuring Tom Kincaid on piano.

This disc is a festive ode to 'A Christmas Carol', featuring Christmas songs you'll know and some you may not!

For the full track listing please see the product images.
Product code BH008
Product condition: New
Add to Cart

Featured Products

'A Swinging Christmas for Scrooge' - The Ben Holder Trio feat. Tom Kincaid
'A Swinging Christmas for Scrooge' - The Ben Holder Trio feat. Tom Kincaid
£12.00
Add To Cart
'Oscar meets Stephane...and Benny's running wild!' - DIGIPAK
'Oscar meets Stephane...and Benny's running wild!' - DIGIPAK
£12.00
Add To Cart
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i